PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG252400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 296aa    MW: 32387.2 Da    PI: 4.8102
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG252400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.3e-1969122356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k++++ ++q+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  Pavir.9KG252400.2.p  69 KKRRLAADQVRALERSFEVDNKLDPERKARIAHDLSLHPRQVAVWFQNRRARWK 122
                          4557899**********************************************9 PP

2HD-ZIP_I/II1253.4e-4068160193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl+++qv++LE+sFe ++kL+perK+++a++L l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal++e ++L++++++L++e
  Pavir.9KG252400.2.p  68 EKKRRLAADQVRALERSFEVDNKLDPERKARIAHDLSLHPRQVAVWFQNRRARWKTKQIERDFAALRARHDALRAECDALRRDKDTLAAE 157
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          ++e
  Pavir.9KG252400.2.p 158 IRE 160
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1948125IPR009057Homeodomain-like
SuperFamilySSF466891.88E-1859126IPR009057Homeodomain-like
PROSITE profilePS5007116.34264124IPR001356Homeobox domain
SMARTSM003894.3E-1967128IPR001356Homeobox domain
CDDcd000864.37E-1669125No hitNo description
PfamPF000462.2E-1669122IPR001356Homeobox domain
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PfamPF021837.8E-15124165IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MKRPTSRGSS MVSQATTDQQ DSCRYMERHG VDGDGGAAAA ERDDMEAGAY DEEDDDDEQA  60
GSRGGLGEKK RRLAADQVRA LERSFEVDNK LDPERKARIA HDLSLHPRQV AVWFQNRRAR  120
WKTKQIERDF AALRARHDAL RAECDALRRD KDTLAAEIRE LREKVERQMD VKLESAEEML  180
PVAAGTAAAA AAAAVYKDGS TDSDSSAVFN EEASPYSGAA FDHQHQHQFH PSFTSFTSFL  240
ASSSSLSSSF PSSLYHGVSH LDQEADGFLS ATAADGFFAE EQGAGLGSWY GSEGW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.178190.0callus| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0420270.0BT042027.1 Zea mays full-length cDNA clone ZM_BFb0113G23 mRNA, complete cds.
GenBankKJ7275560.0KJ727556.1 Zea mays clone pUT5416 HB transcription factor (HB127) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983073.11e-152PREDICTED: homeobox-leucine zipper protein HOX8-like isoform X2
SwissprotQ338Z72e-93HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLK4AM781e-150K4AM78_SETIT; Uncharacterized protein
STRINGSi040014m1e-149(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.17e-34homeobox protein 16